Anti-Cytokeratin 20 Rabbit Monoclonal Antibody [clone: ARC0288]
ANTIA306519-100
New Product
- Antibody type:Primary
- Antigen name:CD20
- Antigen symbol:Cytokeratin 20
- Clonality:Monoclonal
- Clone:ARC0288
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P35900
- Antigen synonyms:Cytokeratin-20|Keratin|CK-20|CK20|CK 20|Cytokeratin20|KA20|K1C20_HUMAN|Cytokeratin 20
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:44 kDa
- Sequence:LANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEVEENI
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 325-424 of human Cytokeratin 20 (KRT20) (P35900).
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC0288] antibody to Cytokeratin 20 for WB and IHC with samples derived from Human and Rat.
- Validated Applications: WB, IHC
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200
Type: Primary
Antigen: Cytokeratin 20
Clonality: Monoclonal
Clone: ARC0288
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Rat