Anti-MPC1 Rabbit Polyclonal Antibody
ANTIA306298-100
New Product
- Antibody type:Primary
- Antigen name:Apoptosis regulating basic protein
- Antigen symbol:MPC1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoPrecipitation:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q9Y5U8
- Antigen synonyms:CGI129|HSPC040 protein|MPC1|dJ68L15.3|CGI 129|Brain protein 44 like protein|BRP44L|HSPC040|Mitochondrial pyruvate carrier 1
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol and 0,01% Thiomersal
- Molecular weight:12 kDa
- Sequence:IISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 50-109 of human MPC1 (NP_057182.1).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to MPC1 for WB and IP with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IP
- Recommended Dilutions: WB: 1:500 to 1:1000, IP: 1:500 to 1:1000
Type: Primary
Antigen: MPC1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat