Anti-COX1 / Cyclooxygenase 1 Rabbit Monoclonal Antibody [clone: ARC0960]
ANTIA306059-100
New Product
- Antibody type:Primary
- Antigen name:COX 1
- Antigen symbol:COX1 / Cyclooxygenase 1
- Clonality:Monoclonal
- Clone:ARC0960
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P23219
- Antigen synonyms:EC 1.14.99.1|Cox3|Partial COX1 proteins, included|COX1|Cyclooxygenase-1|Cyclooxygenase 3, included|COX1 / Cyclooxygenase 1|COX-1|COX 3
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:65 kDa/72 kDa
- Sequence:GLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRI
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 50-150 of human COX1/PTGS1 (P23219).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC0960] antibody to COX1 / Cyclooxygenase 1 for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: COX1 / Cyclooxygenase 1
Clonality: Monoclonal
Clone: ARC0960
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat