Anti-PCK1 / PEPC Rabbit Monoclonal Antibody [clone: ARC56074]
Catalog # ANTIA306044-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen symbol:PCK1 / PEPC
- Clonality:Monoclonal
- Clone:ARC56074
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P35558
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,05% Proclin 300
- Molecular weight:69 kDa
- Sequence:GKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQVNADLPCEIEREILALKQRISQM
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 523-622 of human PCK1 (NP_002582.3).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC56074] antibody to PCK1 / PEPC for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:1000 to 1:5000
Type: Primary
Antigen: PCK1 / PEPC
Clonality: Monoclonal
Clone: ARC56074
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat