Anti-SAHH Rabbit Monoclonal Antibody [clone: ARC2674]
Catalog # ANTIA306026-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:Adenosylhomocysteinase
- Antigen symbol:SAHH
- Clonality:Monoclonal
- Clone:ARC2674
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoPrecipitation:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P23526
- Antigen synonyms:S-adenosyl-L-homocysteine hydrolase|ahcY|SAHH_HUMAN|AdoHcyase|S adenosyl L homocysteine hydrolase|SAHH|S adenosylhomocysteine hydrolase
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:45 kDa
- Sequence:GHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLG
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 300-400 of human AHCY (P23526).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC2674] antibody to SAHH for WB and IP with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IP
- Recommended Dilutions: WB: 1:500 to 1:1000, IP: 1:500 to 1:1000
Type: Primary
Antigen: SAHH
Clonality: Monoclonal
Clone: ARC2674
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat