Anti-UGT1A1 Rabbit Monoclonal Antibody [clone: ARC57750]
Catalog # ANTIA305860-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:BILIQTL1
- Antigen symbol:UGT1A1
- Clonality:Monoclonal
- Clone:ARC57750
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Rat,Mouse
- Form:Liquid
- Gene ID:UniprotID# P22309
- Antigen synonyms:GNT1|Bilirubin-specific UDPGT isozyme 1|HUG BR1|HUGBR1|Bilirubin specific UDPGT isozyme 1|bilirubin UDP glucuronosyltransferase 1 1|bilirubin UDP glucuronosyltransferase isozyme 1|EC 2.4.1.17|HUG-BR1
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,05% Proclin 300
- Sequence:FENDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASLAESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLEFEATQCPNPFSYVPRPLSSH
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100-200 of humanUGT1A1 (NP_000454.1).
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC57750] antibody to UGT1A1 for ICC/IF with samples derived from Mouse and Rat.
- Validated Applications: ICC/IF
- Recommended Dilutions: ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: UGT1A1
Clonality: Monoclonal
Clone: ARC57750
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse, Rat