Anti-JNK1 Rabbit Polyclonal Antibody
Catalog # ANTIA12604-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:AI849689
- Antigen symbol:JNK1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P45983
- Antigen synonyms:c Jun N terminal kinase 1|JNK1A2|JNK 1|JNK-46|JNK|JNK1|c-Jun N-terminal kinase 1|C-JUN kinase 1|EC 2.7.11.24
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,05% Proclin 300
- Molecular weight:44 kDa
- Sequence:CPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDER
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 245-345 of human JNK1 (NP_620635.1)
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to JNK1 for WB, IHC and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, IHC, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:1000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:20
Type: Primary
Antigen: JNK1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat