Anti-MEK1 Rabbit Polyclonal Antibody
ANTIA12575-100
New Product
- Antibody type:Primary
- Antigen name:Dual specificity mitogen activated protein kinase kinase 1
- Antigen symbol:MEK1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q02750
- Antigen synonyms:MAPKK 1|Dual specificity mitogen-activated protein kinase kinase 1|MAP2K1|MAPKK1|MAP kinase/Erk kinase 1|MEK 1|ERK activator kinase 1|MAP kinase kinase 1|MAPK/ERK kinase 1
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:46 kDa
- Sequence:MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIH
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK1 (NP_002746.1)
- Tested applications:ICC/IF
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to MEK1 for WB and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:2000, ICC/IF: 1:50 to 1:10
Type: Primary
Antigen: MEK1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat