Anti-CD103 Rabbit Polyclonal Antibody
ANTIA12422-100
New Product
- Antibody type:Primary
- Antigen name:A530055J10
- Antigen symbol:CD103
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P38570
- Antigen synonyms:alpha-M290|aM290|alpha-E1|HML 1 antigen|CD 103|Antigen CD103|HML-1 antigen|CD103 antigen|HML1 antigen
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,05% Proclin 300
- Molecular weight:25 kDa
- Sequence:FNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRALEKEEEEDKEEEEDEEEEEAG
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 19-200 of human ITGAE (NP_002199.3)
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to CD103 for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:100 to 1:50
Type: Primary
Antigen: CD103
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat