Anti-SLC34A2 Rabbit Polyclonal Antibody
Catalog # ANTIA12364-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:Na(+)-dependent phosphate cotransporter 2B
- Antigen symbol:SLC34A2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# O95436
- Antigen synonyms:SLC34A2|NPT2B_HUMAN|NaPi-2b|Sodium-dependent phosphate transport protein 2B|Sodium-phosphate transport protein 2B|Solute carrier family 34 member 2|NaPi3b|Na(+)/Pi cotransporter 2B|Sodium/phosphate cotransporter 2B
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:76 kDa
- Sequence:EVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDLA
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 234-362 of human SLC34A2 (NP_001171469.1)
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to SLC34A2 for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:200
Type: Primary
Antigen: SLC34A2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat