Anti-Cornulin Rabbit Polyclonal Antibody
Catalog # ANTIA12300-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:53 kDa putative calcium binding protein
- Antigen symbol:Cornulin
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q9UBG3
- Antigen synonyms:C1orf10|CRNN_HUMAN|53 kDa putative calcium-binding protein|Cornulin|Chromosome 1 open reading frame 10|53 kDa squamous epithelial induced stress protein|58 kDa heat shock protein|CRNN|53 kDa squamous epithelial-induced stress protein
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:60 kDa
- Sequence:GETVPGGQAQTGASTESGRQEWSSTHPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRGITARELYSYLRSTKP
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 396-495 of human CRNN (NP_057274.1)
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to Cornulin for WB with samples derived from human and mouse.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:100
Type: Primary
Antigen: Cornulin
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse