Anti-CRY2 Rabbit Polyclonal Antibody
Catalog # ANTIA12034-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:CRY2
- Antigen symbol:CRY2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q49AN0
- Antigen synonyms:FLJ10332|_HUMAN|KIAA0658|Cryptochrome 2|H|Cryptochrome-2|growth inhibiting protein 37|PHLL2|cryptochrome 2 (photolyase like)
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:67 kDa
- Sequence:MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQ
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 230 of human CRY2 (NP_066940.3)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to CRY2 for WB with samples derived from human and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:1000
Type: Primary
Antigen: CRY2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Rat