Anti-PER3 Rabbit Monoclonal Antibody [clone: ARC1893]
Catalog # ANTIA11518-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:2810049O06Rik
- Antigen symbol:PER3
- Clonality:Monoclonal
- Clone:ARC1893
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P56645
- Antigen synonyms:Cell growth inhibiting gene 13 protein|mPer3|hPER3|Growth inhibiting protein 13|HGNC:8847|Cell growth-inhibiting gene 13 protein|GIG13|Circadian clock protein PERIOD 3|gPER3
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol, 0,05% BSA, and 0,02% Sodium Azide
- Molecular weight:132 kDa
- Sequence:GRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQEMKKYFPSERRNKPSTLDALNYALRCVHSVQANSEFFQIL
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 10 - 100 of human PER3 (P56645)
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC1893] antibody to PER3 for WB and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:2000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: PER3
Clonality: Monoclonal
Clone: ARC1893
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat