Anti-CD116 Rabbit Polyclonal Antibody
Catalog # ANTIA11504-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:CD116
- Antigen symbol:CD116
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P15509
- Antigen synonyms:Colony stimulating factor 2 receptor alpha low affinity|CSF2RA|Colony stimulating factor 2 receptor alpha subunit|CD_antigen=|CDw116|antigen|CSF 2R|CSF2R|Colony stimulating factor 2 receptor alpha chain
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:80 kDa
- Sequence:EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 23 - 320 of human CSF2RA (NP_758448.1)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to CD116 for WB with samples derived from human and mouse.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: CD116
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse