Anti-FTSJ1 Rabbit Polyclonal Antibody
ANTIA10255-100
New Product
- Antibody type:Primary
- Antigen name:Mental retardation X linked 9
- Antigen symbol:FTSJ1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q9UET6
- Antigen synonyms:Mental retardation X linked 44|JM23|FtsJ RNA methyltransferase homolog 1|CDLIV|FtsJ homolog 1|MRX44|FtsJ homolog 1 (E. coli)|FTSJ1|FTSJ 1
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:36 kDa
- Sequence:LQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 170 - 329 of human FTSJ1 (NP_036412.1)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to FTSJ1 for WB with samples derived from human.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: FTSJ1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human