Anti-FLVCR2 Rabbit Polyclonal Antibody
Catalog # ANTIA10228-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:Feline leukemia virus subgroup C cellular receptor family, member 2
- Antigen symbol:FLVCR2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q9UPI3
- Antigen synonyms:FLVCR LIKE ON CHROMOSOME 14q|C14orf58|MFSD7C|FLVCR2|Calcium chelate transporter|CCT|FLVCRL14q|EPV|CHROMOSOME 14 OPEN READING FRAME 58
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:57 kDa
- Sequence:MVNEGPNQEESDDTPVPESALQADPSVSVHPSVSVHPSVSINPSVSVHPSSSAHPSALAQPSGLAHPSSSGPEDLSVIKVSRRRWAVVLVFSCYSMCNSF
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 100 of human FLVCR2 (NP_060261.2)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to FLVCR2 for WB with samples derived from human and mouse.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: FLVCR2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse