Anti-ABCD4 Rabbit Polyclonal Antibody
Catalog # ANTIA305629-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:69 kDa peroxisomal ABC transporter
- Antigen symbol:ABCD4
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# O14678
- Antigen synonyms:ABC41|ABC 41|EST352188|ABCD 4|ATP binding cassette sub family D member 4|ATP-binding cassette sub-family D member 4|ABCD4_HUMAN|ATP binding cassette sub family D (ALD) member 4|ABCD4
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,01% thiomersal
- Molecular weight:72 kDa
- Sequence:DQFTCNLLYVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQLSSMASKLIISPFTLVYYTYQCFQSTGWLGPVSIFGYFILGTVVNKTLMGPIVMKLVHQEKLEGDFRFKHMQIRVNAEPAAFYRAGHVEHMRTDRRLQRLLQTQRELMSKELWLYIGINTFDYL
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 100 - 280 of human ABCD4 (NP_005041.1).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to ABCD4 for WB with samples derived from human.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: ABCD4
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human