Anti-Hsp20 Rabbit Monoclonal Antibody [clone: ARC1787]
ANTIA305617-100
New Product
- Antibody type:Primary
- Antigen name:epididymis luminal protein 55
- Antigen symbol:Hsp20
- Clonality:Monoclonal
- Clone:ARC1787
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# O14558
- Antigen synonyms:Heat shock 20 kDa like protein p20|FLJ32389|Heat shock protein beta 6|Heat shock protein, 20-KD|HEL55|Heat shock protein alpha crystallin related B6|Heat-shock 27-KD protein 6|Heat shock 20 kDa-like protein p20|Heat shock protein beta-6
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:17 kDa
- Sequence:DPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 70 - 150 of human HSP20/HSPB6 (O14558).
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC1787] antibody to Hsp20 for WB, IHC and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, IHC, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: Hsp20
Clonality: Monoclonal
Clone: ARC1787
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat