Anti-Integrin beta 3 Rabbit Monoclonal Antibody [clone: ARC0460]
Catalog # ANTIA305528-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:BDPLT16
- Antigen symbol:Integrin beta 3
- Clonality:Monoclonal
- Clone:ARC0460
- Conjugation:Unconjugated
- Flow cytometry:Yes
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoPrecipitation:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P05106
- Antigen synonyms:HPA 1|CD61 antigen|GP3A|BDPLT2|CD 61|HPA 4|GPIIIa|GT|CD61
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:110 kDa
- Sequence:CVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 689 - 788 of human Integrin beta 3 (ITGB3/CD61) (P05106).
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC0460] antibody to Integrin beta 3 for WB, IHC, IP and Flow cytometry with samples derived from human, mouse and rat.
- Validated applications: WB, IHC, IP, Flow cytometry
- Recommended dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200, IP: 1:500 to 1:1000, Flow cytometry: 1:50 to 1:200
Type: Primary
Antigen: Integrin beta 3
Clonality: Monoclonal
Clone: ARC0460
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat