Anti-TrkA Rabbit Monoclonal Antibody [Clone: ARC0906]
Catalog # ANTIA305801-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:gp140trk
- Antigen symbol:TrkA
- Clonality:Monoclonal
- Clone:ARC0906
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P04629
- Antigen synonyms:p140 TrkA|High affinity nerve growth factor receptor|MTC|Neurotrophic tyrosine kinase receptor type 1|NTRK1_HUMAN|High affinity nerve growth factor receptor precursor|Oncogene TRK|NTRK1|p14-TrkA
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:130 kDa
- Sequence:ESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 697 - 796 of human TrkA (P04629).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC0906] antibody to TrkA for WB with samples derived from mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: TrkA
Clonality: Monoclonal
Clone: ARC0906
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse, Rat