Anti-EGFR Rabbit Monoclonal Antibody [Clone: ARC1139]
ANTIA305672-100
New Product
- Antibody type:Primary
- Antigen name:9030024J15Rik
- Antigen symbol:EGFR
- Clonality:Monoclonal
- Clone:ARC1139
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P00533
- Antigen synonyms:EGFR_HUMAN|EGF R|Cell growth inhibiting protein 40 |EGFR|Cell proliferation inducing protein 61 |Avian erythroblastic leukemia viral (v erb b) oncogene homolog |AI552599|Epidermal growth factor receptor|Avian erythroblastic leukemia viral (verbb) oncogene homolog
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:175 kDa
- Sequence:DYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 800 - 900 of human EGFR (L858R) (P00533).
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC1139] antibody to EGFR for WB and IHC with samples derived from human and mouse.
- Validated applications: WB, IHC
- Recommended dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200
Type: Primary
Antigen: EGFR
Clonality: Monoclonal
Clone: ARC1139
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse