Recombinant DegP from E. coli
DegP acts as a chaperone at low temperatures but switches to a peptidase (heat shock protein) at higher temperatures. It degrades transiently denatured and unfolded proteins which accumulate in the periplasm following heat shock or other stress conditions.
- Recombinant protein corresponding to aa 27 - 474 from E. coli degP, fused to His-Tag at N-terminal, expressed in Yeast
DegP is efficient with Val-Xaa and Ile-Xaa peptide bonds, suggesting a preference for beta-branched side chain amino acids. Only unfolded proteins devoid of disulfide bonds appear capable of being cleaved, thereby preventing non-specific proteolysis of folded proteins. Its proteolytic activity is essential for the survival of cells at elevated temperatures. It can degrade IciA, ada, casein, globin and PapA. DegP shares specificity with DegQ. DegP is also involved in the biogenesis of partially folded outer-membrane proteins (OMP).
DegP acts as a chaperone at low temperatures but switches to a peptidase (heat shock protein) at higher temperatures. It degrades transiently denatured and unfolded proteins which accumulate in the periplasm following heat shock or other stress conditions.
- Recombinant protein corresponding to aa 27 - 474 from E. coli degP, fused to His-Tag at N-terminal, expressed in Yeast
DegP is efficient with Val-Xaa and Ile-Xaa peptide bonds, suggesting a preference for beta-branched side chain amino acids. Only unfolded proteins devoid of disulfide bonds appear capable of being cleaved, thereby preventing non-specific proteolysis of folded proteins. Its proteolytic activity is essential for the survival of cells at elevated temperatures. It can degrade IciA, ada, casein, globin and PapA. DegP shares specificity with DegQ. DegP is also involved in the biogenesis of partially folded outer-membrane proteins (OMP).
- Catalog No:
- BMOL373034.20
- BMOL373034.100
- Protein/peptide name:
- DegP
- DegP
- Protein synonyms:
- htrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161
- htrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161
- Protein/peptide type:
- Recombinant
- Recombinant
- Source:
- E. coli
- E. coli
- Conjugation:
- Unconjugated
- Unconjugated
- Gene ID:
- 947139
- 947139
- Sequence:
- AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ - AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
- Amino acid number:
- 27 - 474
- 27 - 474
- UniProtKB:
- P0C0V0
- P0C0V0
- Purity:
- ≥90% (SDS-PAGE)
- ≥90% (SDS-PAGE)
- Formulation:
- Supplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerol
- Supplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerol
- Molecular weight:
- 48,8 kD
- 48,8 kD
- Storage conditions:
- May be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- May be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping temperature:
- 4 °C
- 4 °C
Product Family Options
- Pk
Specifications
Cat. No.BMOL373034.20Protein/peptide nameDegPProtein synonymshtrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161Protein/peptide typeRecombinantSourceE. coliConjugationUnconjugatedGene ID947139SequenceAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQAmino acid number27 - 474UniProtKBP0C0V0Purity≥90% (SDS-PAGE)FormulationSupplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerolMolecular weight48,8 kDStorage conditionsMay be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.Shipping temperature4 °CSpecifications
Cat. No.BMOL373034.100Protein/peptide nameDegPProtein synonymshtrA|Protease Do|Periplasmic serine endoprotease DegP|Heat shock protein DegP|b0161Protein/peptide typeRecombinantSourceE. coliConjugationUnconjugatedGene ID947139SequenceAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGG
NGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIK
MADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAIL
APDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIK
AGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGK
DQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQAmino acid number27 - 474UniProtKBP0C0V0Purity≥90% (SDS-PAGE)FormulationSupplied as a liquid in 20 mM Tris-HCl, pH 8,0, 50% glycerolMolecular weight48,8 kDStorage conditionsMay be stored at 4 °C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at –20 °C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.Shipping temperature4 °C