Recombinant COL11A1 (from E. coli)
100 µG
Catalog # NOVUNBP2-58159PEP
Supplier: Novus Biologicals
Recombinant COL11A1 (from E. coli)
Catalog # NOVUNBP2-58159PEP
Supplier: Novus Biologicals
CAS Number:
Jump to:
Product Details & Documents
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COL11A1.
The COL11A1 gene encodes one of the two alpha chains of type XI collagen, a minor fibrillar collagen. Type XI collagen is aheterotrimer but the third alpha chain is a post-translationally modified alpha 1 type II chain. Mutations in thisgene are associated with
Specifications
Specifications
- Pk:100 µG
- Cat. No.:NOVUNBP2-58159PEP
- Protein/peptide type:Recombinant
- Protein/peptide name:COL11A1
- Formulation:PBS and 1M Urea, pH 7.4. No Preservative
- Protein synonyms:COLL6|collagen, type XI, alpha 1|alpha-1 polypeptide
- Amino acid number:DCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEANIVDDFQEYNYG
- Purity:>80% by SDS-PAGE and Coomassie blue staining
- Conjugation:Unconjugated
- Species:Human
- Source:E. coli