Mouse Recombinant IL-19 (Animal free) (from E. coli)
Supplier: Shenandoah Biotechnology
Certificates
About this item
Macrophage Inflammatory Protein 2 (MIP-2), also known as CXCL2, is a small cytokine that is secreted by monocytes and neutrophils at sites of inflammation. MIP-2 functions through the chemokine receptor CXCR2 to act as a chemotactic agent for leukocytes and hematopoietic cells.
- High quality
- Low endotoxin
- Affordable
IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
Certifications: Animal-Free (AF) proteins are identical to regular proteins and offer additional documentation showing that they were produced with no materials of animal or human origin using ANIMAL-FREE purification processes.
Caution: For research use only.
Specifications
- Conjugation:Unconjugated
- Protein function:Cytokine
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Mouse
- Storage conditions:−20 °C
- Endotoxin content:Endotoxin LAL (EU/µg) ≤0.1
- Biological activity:Bioactivity: No biological activity data is available at this time
- Gene ID:Q8CJ70
- Reconstitution instructions:Sterile water at 0,1 mg/ml
- Endotoxin-free:N
- Carrier-free:Y
- Protease-free:N
- Animal-free:Y
- Protein synonyms:IL19|IL-19|Interleukin 19
- UniProtKB:Q8CJ70
- Protein/peptide name:IL-19
- Purity:≥95%
- Molecular weight:17,7 kDa
- Sequence:MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
- Endotoxin level:Low
- Formulation:10 mM sodium phosphate, 50 mM sodium chloride, pH 7,5
- Nuclease-free:N
- Grade:RUO
- Shipping temperature:RT