Human recombinant ACP1 (from E. coli)
: Biorbyt
- Catalog No:
- BIRBORB49516-10
- BIRBORB49516-50
- BIRBORB49516-1
- Protein/peptide name:
- ACP1
- ACP1
- ACP1
- Protein synonyms:
- Low Molecular Weight Phosphotyrosine Phosphatase
- Low Molecular Weight Phosphotyrosine Phosphatase
- Low Molecular Weight Phosphotyrosine Phosphatase
- Protein/peptide type:
- Recombinant
- Recombinant
- Recombinant
- Species:
- Human
- Human
- Human
- Source:
- E. coli
- E. coli
- E. coli
- Conjugation:
- Unconjugated
- Unconjugated
- Unconjugated
- Sequence:
- AEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRN HGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDP YYGNDSDFETVYQQCVRCCRAFLEKAHLEHHHHHH
- AEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRN HGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDP YYGNDSDFETVYQQCVRCCRAFLEKAHLEHHHHHH
- AEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRN HGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDP YYGNDSDFETVYQQCVRCCRAFLEKAHLEHHHHHH
- UniProtKB:
- P24666 (Human)
- P24666 (Human)
- P24666 (Human)
- Purity:
- >95% as determined by reducing SDS-PAGE.
- >95% as determined by reducing SDS-PAGE.
- >95% as determined by reducing SDS-PAGE.
- Formulation:
- Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0.
- Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0.
- Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0.
- Storage conditions:
- Store at −20 °C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
- Store at −20 °C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
- Store at −20 °C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
- Tested applications:
- SDS-PAGE
- SDS-PAGE
- SDS-PAGE
Product Family Options
- Pk
Specifications
Cat. No.BIRBORB49516-10Protein/peptide nameACP1Protein synonymsLow Molecular Weight Phosphotyrosine PhosphataseProtein/peptide typeRecombinantSpeciesHumanSourceE. coliConjugationUnconjugatedSequenceAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRN HGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDP YYGNDSDFETVYQQCVRCCRAFLEKAHLEHHHHHHUniProtKBP24666 (Human)Purity>95% as determined by reducing SDS-PAGE.FormulationSupplied as a 0.2 um filtered solution of 20mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0.Storage conditionsStore at −20 °C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.Tested applicationsSDS-PAGESpecifications
Cat. No.BIRBORB49516-50Protein/peptide nameACP1Protein synonymsLow Molecular Weight Phosphotyrosine PhosphataseProtein/peptide typeRecombinantSpeciesHumanSourceE. coliConjugationUnconjugatedSequenceAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRN HGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDP YYGNDSDFETVYQQCVRCCRAFLEKAHLEHHHHHHUniProtKBP24666 (Human)Purity>95% as determined by reducing SDS-PAGE.FormulationSupplied as a 0.2 um filtered solution of 20mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0.Storage conditionsStore at −20 °C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.Tested applicationsSDS-PAGESpecifications
Cat. No.BIRBORB49516-1Protein/peptide nameACP1Protein synonymsLow Molecular Weight Phosphotyrosine PhosphataseProtein/peptide typeRecombinantSpeciesHumanSourceE. coliConjugationUnconjugatedSequenceAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRN HGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDP YYGNDSDFETVYQQCVRCCRAFLEKAHLEHHHHHHUniProtKBP24666 (Human)Purity>95% as determined by reducing SDS-PAGE.FormulationSupplied as a 0.2 um filtered solution of 20mM TrisHCl, 150mM NaCl, 10% Glycerol, pH 8.0.Storage conditionsStore at −20 °C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.Tested applicationsSDS-PAGE



