Specifications
- Antibody type:Primary
- Antigen name:anti-Mullerian hormone receptor, type II
- Antigen symbol:AMHR2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat
- Western blot:Yes
- Cross adsorption:No
- Form:Lyophilized
- Gene ID:269
- Antigen synonyms:MISR2|AMHR|MISRII|MRII
- Storage temperature:At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
- Immunogen:A synthetic peptide corresponding to a sequence at the C-terminus of human AMHR2 (384-419aa QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE), different from the related mouse and rat sequences by three amino acids.
- Size:100 μg
- Pk:100 µG
Specifications
About this item
AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.
1. Behringer RR (1994). "The in vivo roles of müllerian-inhibiting substance". Current Topics in Developmental Biology. Current Topics in Developmental Biology 29: 171–87.
2. Cate RL, Mattaliano RJ, Hession C, Tizard R, Farber NM, Cheung A, Ninfa EG, Frey AZ, Gash DJ, Chow EP (Jun 1986). "Isolation of the bovine and human genes for Müllerian inhibiting substance and expression of the human gene in animal cells". Cell 45 (5): 685–98.
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.