Anti-AKT1 Rabbit Polyclonal Antibody
Catalog # ABNOPAB28728
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:V-Akt Murine Thymoma Viral Oncogene Homolog 1
- Antigen symbol:AKT1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:207
- Antigen synonyms:AKT2|RAC|RAC-gamma serine/threonine-protein kinase|PKB-GAMMA|RAC-BETA|PKBG|kinase Akt1|Murine thymoma viral (v-akt) homolog-2|rac protein kinase beta|Protein kinase B beta|PKBB|RAC-PK-beta|EC 2.7.11.1|PKB|AKT|RAC-PK-gamma|PKB beta|RAC-PK-alpha|AKT1 kinase|RAC-beta serine/threonine-protein kinase|C-AKT|RAC-gamma serine/threonine protein kinase|v-akt murine thymoma viral oncogene homolo|PKB gamma|STK-2|Protein kinase B|PRKBB|PKBBETA|PKB-alpha|RAC-gamma|PRKBG|Protein kinase Akt-2|RAC-alpha serine/threonine kinase
- Storage buffer:PBS, pH 7,2 (40% glycerol, 0,02% sodium azide).
- Sequence:ERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVA
- Storage temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human AKT1.
- Purification:Antigen affinity purification
- Size:100 μl
- Pk:100 µg
Specifications
About this item
Rabbit polyclonal antibody raised against recombinant AKT1.
Recommended Dilutions: Immunohistochemistry: 1:50-1:200; Immunofluorescence: 1-4 ?g/ml; Western Blot: 1:100-1:250
Type: Primary
Antigen: AKT1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: