Anti-UFSP2 Rabbit Polyclonal Antibody
Catalog # ABNOPAB24028
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:UFM1-specific peptidase 2
- Antigen symbol:UFSP2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:55325
- Antigen synonyms:C4orf20|BHD
- Storage buffer:PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
- Sequence:LAFQLATPNEIFLKKALKHVLSDLSTKLSSNALVFRICHSSVYIWPSSDINTIPGELTDASACKNILRFIQFEPEED
- Storage temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human UFSP2.
- Purification:Antigen affinity purification
- Size:100 μl
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody raised against recombinant UFSP2.
Recommended Dilutions: Immunohistochemistry: 1:500-1:1000; Western Blot: 1:250-1:500
Type: Primary
Antigen: UFSP2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human