Anti-CRYAB Mouse Monoclonal Antibody [clone: 1329CT523.140.120]
Catalog # ABGEAM8424B
Supplier: Abgent
Specifications
- Antibody type:Primary
- Antigen name:Crystallin, alpha B
- Antigen symbol:CRYAB
- Clonality:Monoclonal
- Clone:1329CT523.140.120
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG1 kappa
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Gene ID:1410
- Antigen synonyms:HSPB5|CRYA2|CMD1II|CTPP2|HEL-S-101|CTRCT16|MFM2
- Storage buffer:pH 7,4
- Molecular weight:20.159 kDa
- Sequence:MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
- Storage temperature:Maintain refrigerated at 2-8 °C for up to 6 months. For long term storage store at –20 °C in small aliquots to prevent freeze-thaw cycles
- Concentration:1.230
- Shipping temperature:4 °C
- Immunogen:This CRYAB antibody is generated from a mouse immunized with a recombination protein from the human region of human CRYAB.
- Purification:Protein G Purification
- Pk:400 µl
Specifications
About this item
Type: Primary
Antigen: CRYAB
Clonality: Monoclonal
Clone: 1329CT523.140.120
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: Human, Mouse, Rat