Anti-BCL10 Mouse Monoclonal Antibody [clone: 1185CT13.2.1.2]
Catalog # ABGEAM2259B
Supplier: Abgent
Specifications
- Antibody type:Primary
- Antigen name:B-cell CLL/lymphoma 10
- Antigen symbol:BCL10
- Clonality:Monoclonal
- Clone:1185CT13.2.1.2
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG1 kappa
- Reactivity:Human
- Western blot:Yes
- Gene ID:8915
- Antigen synonyms:c-E10|IMD37|mE10|CIPER|CLAP|CARMEN
- Storage buffer:pH 7,4
- Molecular weight:26.252 kDa
- Sequence:MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDESNF
- Storage temperature:Maintain refrigerated at 2-8 °C for up to 6 months. For long term storage store at –20 °C in small aliquots to prevent freeze-thaw cycles
- Concentration:0.56
- Shipping temperature:4 °C
- Immunogen:This BCL10 antibody is generated from a mouse immunized with a KLH conjugated synthetic peptide between 1-143 amino acids from the human region of human BCL10.
- Purification:Protein G Purification
- Pk:400 µl
Specifications
About this item
Type: Primary
Antigen: BCL10
Clonality: Monoclonal
Clone: 1185CT13.2.1.2
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: Human