Anti-Iba1 Rabbit Polyclonal Antibody
Catalog # ANTIA14379-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:AIF 1
- Antigen symbol:Iba1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Form:Liquid
- Gene ID:UniprotID# P55008
- Antigen synonyms:AIF-1|allograft inflammatory factor-1 splice variant Hara-1|Aif1|AIF1_HUMAN|balloon angioplasty responsive transcription|Allograft inflammatory factor 1|BART 1|Allograft inflammatory factor 1 splice variant G|AIF1 protein
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Sequence:MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human AIF1/IBA1 (P55008)
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to Iba1 for IHC and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: IHC, ICC/IF
- Recommended dilutions: IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:20
Type: Primary
Antigen: Iba1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat