Anti-C Reactive Protein Rabbit Polyclonal Antibody
ANTIA11127-100
New Product
- Tipo de anticuerpo:Primario
- Nombre del antígeno:C Reactive Protein
- Simbolo antígeno:C Reactive Protein
- Clonalidad:Polyclonal
- Conjugado:Unconjugated
- Huésped:Rabbit
- InmunoQuímica:Yes
- Isotipo:IgG
- Reactividad:Human,Rat,Mouse
- Western blot:Yes
- Forma:Liquid
- ID del gen:UniprotID# P02741
- Sinónimos de antígenos:PTX 1|Pentraxin 1, short|CRP|C-reactive protein(1-205)|pentraxin related|Pentraxin 1|MGC88244|CRP_HUMAN|PTX1
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:25 kDa
- Sequence:ILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSP
- Temperatura de almacenamiento:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Inmunógeno:A synthetic peptide corresponding to a sequence within amino acids 100 - 200 of human C - Reactive Protein (CRP) (NP_000558.2)
- Tested applications:ICC/IF
- Purification:Affinity purification
- Tipo de env.:Plastic vial
- Env:100 µl
Rabbit polyclonal antibody to C Reactive Protein for WB and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:2000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: C Reactive Protein
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat