Human Recombinant FOXA1
: OriGene
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.
- Expression host: HEK293T
- Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7,3, 10% glycerol
Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
- Protein/peptide type:Recombinant
- Species:Human
- Tag sequence:C-Myc/DDK
- Storage conditions:Store at −80 °C
- Protein synonyms:HNF3A|forkhead box A1|TCF3A
- UniProtKB:P55317
- Protein/peptide name:FOXA1
- Purity:>80% as determined by SDS-PAGE and Coomassie blue staining
- Molecular weight:49 kDa
- Sequence:MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYAN
PGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSP
MAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQN
QQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGS
GSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELK
TPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY
EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
myc-FLAG tag - Concentration:>0,05 µg/µl as determined by microplate BCA method
Frequently Bought Together