Anti-Galectin 3 Rabbit Monoclonal Antibody [clone: ARC0542]
Catalog # ANTIA306857-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:35 kDa lectin
- Antigen symbol:Galectin 3
- Clonality:Monoclonal
- Clone:ARC0542
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoPrecipitation:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# P17931
- Antigen synonyms:Carbohydrate-binding protein 35|Galactose-specific lectin 3|GAL3|CBP35|GALBP|CBP 35|Carbohydrate binding protein 35|Gal-3|Galactoside-binding protein
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:28 kDa
- Sequence:MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGA
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Galectin 3/LGALS3 (P17931).
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC0542] antibody to Galectin 3 for WB, IHC and IP with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC, IP
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200, IP: 1:500 to 1:1000
Type: Primary
Antigen: Galectin 3
Clonality: Monoclonal
Clone: ARC0542
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat