Anti-Dnmt1 Rabbit Monoclonal Antibody [clone: ARC51348]
Catalog # ANTIA307587-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:ADCADN
- Antigen symbol:Dnmt1
- Clonality:Monoclonal
- Clone:ARC51348
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoPrecipitation:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- ChIP:Yes
- Form:Liquid
- Gene ID:UniprotID# P26358
- Antigen synonyms:DNA methyltransferase M.HsaI.|CXXC9|DNA methyltransferase HsaI|AIM|CXXC finger protein 9|DNA (cytosine-5)-methyltransferase 1|CXXC-type zinc finger protein 9|DNA (cytosine 5 ) methyltransferase 1|DNA methyltransferase 1
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,05% Proclin 300
- Molecular weight:200 kDa
- Sequence:MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYN
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNMT1 (NP_001370.1)
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC51348] antibody to Dnmt1 for WB, ICC/IF, IP and ChIP with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, ICC/IF, IP, ChIP
- Recommended Dilutions: WB: 1:500 to 1:1000, ICC/IF: 1:50 to 1:200, IP: 1:500 to 1:1000, ChIP: 1:50 to 1:200
Type: Primary
Antigen: Dnmt1
Clonality: Monoclonal
Clone: ARC51348
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat