Anti-EZH2 Rabbit Polyclonal Antibody
ANTIA14944-100
New Product
- Antibody type:Primary
- Antigen name:Enhancer of zeste 2
- Antigen symbol:EZH2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoPrecipitation:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q15910
- Antigen synonyms:Enhancer of zeste homolog 2 (Drosophila)|enhancer of zeste 2 polycomb repressive complex 2 subunit|Enx1h|ENX1|Enhancer of zeste, Drosophila, homolog 2|Enhancer of zeste homolog 2|ENX-1|Enx 1h|ENX 1
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,05% Proclin 300
- Molecular weight:98 kDa
- Sequence:YMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQL
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 133-252 of human EZH2/KMT6 (NP_001190176.1)
- Tested applications:IHC
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to EZH2 for WB, IHC and IP with samples derived from human, mouse and rat.
- Validated applications: WB, IHC, IP
- Recommended dilutions: WB: 1:500 to 1:1000, IHC: 1:50 to 1:200, IP: 1:500 to 1:100
Type: Primary
Antigen: EZH2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat