Specifications
- Pk:0,1 mL
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Environmentally Preferable:
- Amino acid number:LVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAG
- Protein synonyms:annexin A5|Placental anticoagulant protein I|Vascular anticoagulant-alpha|Endonexin II|Calphobindin I|ANXA5|Anchorin CII|PAP-I|Thromboplastin inhibitor|ANXV|ANX5|VAC-alpha|PP4|ENX2CBP-I|Lipocortin V|Placental anticoagulant protein 4
- Protein/peptide name:Annexin V
- Purity:>80% by SDS-PAGE and Coomassie blue staining
- Formulation:PBS and 1M Urea, pH 7.4. No Preservative
Specifications
About this item
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANXA5.
Annexin V is encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa.