Order Entry
Denmark
ContactUsLinkComponent
Recombinant Annexin V (from E. coli)
Recombinant Annexin V (from E. coli)
Catalog # NOVUNBP2-38248PEP
Supplier:  Novus Biologicals
CAS Number:  
Recombinant Annexin V (from E. coli)
Catalog # NOVUNBP2-38248PEP
Supplier:  Novus Biologicals
CAS Number:  

Specifications

  • Pk:
    0,1 mL
  • Conjugation:
    Unconjugated
  • Protein/peptide type:
    Recombinant
  • Source:
    E. coli
  • Species:
    Human
  • Environmentally Preferable:
  • Amino acid number:
    LVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAG
  • Protein synonyms:
    annexin A5|Placental anticoagulant protein I|Vascular anticoagulant-alpha|Endonexin II|Calphobindin I|ANXA5|Anchorin CII|PAP-I|Thromboplastin inhibitor|ANXV|ANX5|VAC-alpha|PP4|ENX2CBP-I|Lipocortin V|Placental anticoagulant protein 4
  • Protein/peptide name:
    Annexin V
  • Purity:
    >80% by SDS-PAGE and Coomassie blue staining
  • Formulation:
    PBS and 1M Urea, pH 7.4. No Preservative

Specifications

About this item

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANXA5.

Annexin V is encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa.