Anti-NOP10 Mouse Monoclonal Antibody [clone: 6H6]
ABNOH00055505-M01
: Abnova
- Antibody type:Primary
- Antigen name:NOP10 ribonucleoprotein
- Antigen symbol:NOP10
- Clonality:Monoclonal
- Clone:6H6
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:55505
- Antigen synonyms:NOLA3|NOP10P|DKCB1
- Amino acid number:1 to 64
- Storage buffer:1x PBS, pH 7,4
- Sequence:MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:NOP10 (NP_061118.1, 1 a.a. ~ 64 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Mouse monoclonal antibody raised against a partial recombinant NOP10.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: NOP10
Clonality: Monoclonal
Clone: 6H6
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human