Anti-CDK2 Rabbit Monoclonal Antibody [clone: ARC0222]
Catalog # ANTIA308527-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:Cdc2 related protein kinase
- Antigen symbol:CDK2
- Clonality:Monoclonal
- Clone:ARC0222
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P24941
- Antigen synonyms:CDKN2|CDK1|CDK2_HUMAN|cdc2-related protein kinase|Cdk 2|CDC28|Cell devision kinase 2|CDC2A|Cdk2
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:33 kDa (mouse)/38 kDa (rat)
- Sequence:RRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 199-298 of human CDK2 (P24941)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC0222] antibody to CDK2 for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:1,000
Type: Primary
Antigen: CDK2
Clonality: Monoclonal
Clone: ARC0222
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat