Anti-CNN3 Mouse Monoclonal Antibody [clone: 4C4]
ABNOH00001266-M01
: Abnova
- Antibody type:Primary
- Antigen name:calponin 3, acidic
- Antigen symbol:CNN3
- Clonality:Monoclonal
- Clone:4C4
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:1266
- Amino acid number:1 to 329
- Storage buffer:1x PBS, pH 7,4
- Sequence:MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:CNN3 (NP_001830.1, 1 a.a. ~ 329 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Mouse monoclonal antibody raised against a full-length recombinant CNN3.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: CNN3
Clonality: Monoclonal
Clone: 4C4
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human