Anti-HIF-2-alpha Rabbit Polyclonal Antibody
Catalog # ANTIA10163-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:Basic helix loop helix PAS protein MOP2
- Antigen symbol:HIF-2-alpha
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q99814
- Antigen synonyms:bHLHe73|Basic-helix-loop-helix-PAS protein MOP2|Endothelial pas domain protein 1|ECYT4|Class E basic helix-loop-helix protein 73|EPAS-1|EPAS 1|Endothelial PAS domain containing protein 1|Endothelial PAS domain-containing protein 1
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,05% Proclin 300
- Molecular weight:120 kDa
- Sequence:TFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRG
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 678 - 745 of human EPAS1/HIF2a (NP_001421.2)
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to HIF-2 alpha for WB, IHC and ICC/IF with samples derived from human and mouse.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: HIF-2-alpha
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse