Anti-Interferon alpha 10 Rabbit Polyclonal Antibody
Catalog # ANTIA93240-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:IFN-alpha-10
- Antigen symbol:Interferon alpha 10
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Rat
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P01566
- Antigen synonyms:Interferon alpha C|IFNA10|interferon, alpha 10|Interferon alpha-10|Interferon alpha-C|IFN10_HUMAN|Interferon alpha 6L|Interferon alpha-6L|Interferon alpha10
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:25 kDa
- Sequence:CDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAW
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 24-100 of human IFNA10 (NP_002162.1)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to Interferon alpha 10 for WB with samples derived from Rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2,000
Type: Primary
Antigen: Interferon alpha 10
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Rat