Anti-IP10 Rabbit Polyclonal Antibody
ANTIA309104-100
New Product
- Antibody type:Primary
- Antigen name:10 kDa interferon gamma induced protein
- Antigen symbol:IP10
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P02778
- Antigen synonyms:CRG2|Chemokine CXC motif ligand 10|CXCL10(1-73)|C7|CXCL10|C X C motif chemokine 10|10 kDa interferon gamma-induced protein|Crg 2|Chemokine (C X C motif) ligand 10
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,05% Proclin 300
- Molecular weight:11 kDa
- Sequence:VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 22-98 of human CXCL10/IP-10 (NP_001556.2).
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to IP10 for WB and ICC/IF with samples derived from human and mouse.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:1,000 to 1:5,000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: IP10
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse