Anti-Abhd5/CGI-58 Rabbit Monoclonal Antibody [clone: ARC1777]
Katalogové číslo ANTIA308941-100
Dodavatel: Antibodies.com
New Product
Specifikace
- Antibody type:Primary
- Antigen name:Abhd5 / CGI-58
- Antigen symbol:Abhd5 / CGI-58
- Clonality:Monoclonal
- Clone:ARC1777
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q8WTS1
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:42 kDa
- Sequence:TNRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIPVWIRA
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABHD5 (Q8WTS1).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifikace
O tomto produktu
Rabbit monoclonal [ARC1777] antibody to Abhd5/CGI-58 for WB with samples derived from human and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2,000
Type: Primary
Antigen: Abhd5 / CGI-58
Clonality: Monoclonal
Clone: ARC1777
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Rat