Anti-Proteasome 20S LMP2 Rabbit Monoclonal Antibody [clone: ARC1629]
ANTIA308367-100
New Product
- Antibody type:Primary
- Antigen name:Beta1i
- Antigen symbol:Proteasome 20S LMP2
- Clonality:Monoclonal
- Clone:ARC1629
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P28065
- Antigen synonyms:Multicatalytic endopeptidase complex chain 7|LMP 2|OTTHUMP00000062982|MGC70470|LMP2|Macropain chain 7|Large multifunctional peptidase 2|Large multifunctional protease 2|Low molecular mass protein 2
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:21 kDa
- Sequence:QREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 125-219 of human PSMB9/LMP2 (P28065)
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC1629] antibody to Proteasome 20S LMP2 for WB and IHC with samples derived from human, mouse and rat.
- Validated applications: WB, IHC
- Recommended dilutions: WB: 1:500 to 1:2,000, IHC: 1:50 to 1:200
Type: Primary
Antigen: Proteasome 20S LMP2
Clonality: Monoclonal
Clone: ARC1629
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat