Anti-UAP56 Rabbit Monoclonal Antibody [clone: ARC1731]
Catalog # ANTIA308352-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:0610030D10Rik
- Antigen symbol:UAP56
- Clonality:Monoclonal
- Clone:ARC1731
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q13838
- Antigen synonyms:B(0,+)-type amino acid transporter 1|D17H6S81E-1|D17H6S81E|ATP-dependent RNA helicase p47|56 kDa U2AF65-associated protein|BAT1|AI428441|4F2-LC6|Bat1a
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:49 kDa
- Sequence:QNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 310-428 of human UAP56/DDX39B (Q13838)
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC1731] antibody to UAP56 for WB and IHC with samples derived from human, mouse and rat.
- Validated applications: WB, IHC
- Recommended dilutions: WB: 1:500 to 1:2,000, IHC: 1:50 to 1:200
Type: Primary
Antigen: UAP56
Clonality: Monoclonal
Clone: ARC1731
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat