Anti-AMPK beta 1 Rabbit Polyclonal Antibody
ANTIA307377-100
New Product
- Antibody type:Primary
- Antigen name:1300015D22Rik
- Antigen symbol:AMPK beta 1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q9Y478
- Antigen synonyms:AMPK beta 1 chain|AMPK|5'-AMP-activated protein kinase beta-1 subunit|AMP-activated, noncatalytic, beta-1|5''-AMP-activated protein kinase subunit beta-1|AAKB1_HUMAN|AMP-activated protein kinase beta subunit|AMPK beta 1|AMP-ACTIVATED PROTEIN KINASE, NONCATALYTIC, BETA-1
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol and 0,02% sodium azide
- Sequence:MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNW
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AMPKß1 (NP_006244.2).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to AMPK beta 1 for WB with samples derived from Human.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: AMPK beta 1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human