Anti-GST3/GST pi Rabbit Monoclonal Antibody [clone: ARC0439]
Catalog # ANTIA306698-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:Deafness
- Antigen symbol:GST3 / GST pi
- Clonality:Monoclonal
- Clone:ARC0439
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P09211
- Antigen synonyms:GST class-pi|Glutathione S-transferase pi 1|Glutathione S-transferase P|Fatty Acid Ethyl Ester Synthase III|Glutathione S Transferase 3|Glutathione S Transferase Pi|Deafness X-linked 7|DFN7|FAEES3
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:25 kDa
- Sequence:LRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVN
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 100-201 of human GST3/GSTP1 (P09211).
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC0439] antibody to GST3/GST pi for WB and IHC with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200
Type: Primary
Antigen: GST3 / GST pi
Clonality: Monoclonal
Clone: ARC0439
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat