Anti-AMPK gamma 1 Rabbit Polyclonal Antibody
Catalog # ANTIA306476-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:5' AMP activated protein kinase gamma 1 subunit
- Antigen symbol:AMPK gamma 1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P54619
- Antigen synonyms:5''-AMP-activated protein kinase subunit gamma-1|AMPK subunit gamma-1|AMPKg|5' AMP activated protein kinase subunit gamma 1|AMPK gamma 1 chain|AAKG1_HUMAN|AMP activated protein kinase noncatalytic gamma 1 subunit|AMPK gamma 1|AMPK gamma1
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol and 0,05% Proclin 300
- Molecular weight:37 kDa
- Sequence:KSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGT
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100-200 of human AMPK?1 (NP_002724.1).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to AMPK gamma 1 for WB with samples derived from Human and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:100 to 1:500
Type: Primary
Antigen: AMPK gamma 1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Rat