Anti-AMSH Rabbit Monoclonal Antibody [clone: ARC2840]
Catalog # ANTIA305903-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen symbol:AMSH
- Clonality:Monoclonal
- Clone:ARC2840
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Monkey,Human
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# O95630
- Antigen synonyms:MGC126518|STAM-binding protein|Associated molecule with the SH3 domain of STAM|Endosome associated ubiquitin isopeptidase|STABP_HUMAN|MGC126516|Endosome-associated ubiquitin isopeptidase|STAM binding protein|MICCAP
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:50 kDa
- Sequence:FPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDL
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100-200 of human AMSH (O95630).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC2840] antibody to AMSH for WB with samples derived from Human and Monkey.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:1000
Type: Primary
Antigen: AMSH
Clonality: Monoclonal
Clone: ARC2840
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Monkey